Human nedd4 3rd ww domain complex with the human t-cell leukemia virus 1 gag-pro poliprotein derived peptide sdpqipppyvep
PDB DOI: 10.2210/pdb2kpz/pdb
Classification: LIGASE Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2009-10-23 Deposition Author(s): Blanco, F.J. , Bonet, R. , Cobos, E.S. , Iglesias-Bexiga, M. , Luque, I. , Macias, M.
Method: SOLUTION NMR Resolution: N.A.
Human nedd4 3rd ww domain complex with the human t-cell leukemia virus 1 gag-pro poliprotein derived peptide sdpqipppyvep
Blanco, F.J. , Bonet, R. , Cobos, E.S. , Iglesias-Bexiga, M. , Luque, I. , Macias, M.
Primary Citation of Related Structures: 2KPZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| E3 ubiquitin-protein ligase NEDD4 | A | 49 | Homo Sapiens , Synthetic Construct | GAMGPSEIEQGFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAH |
| 12-mer from Gag-Pro polyprotein | B | 12 | Homo Sapiens , Synthetic Construct | SDPQIPPPYVEP |
Method: SOLUTION NMR
Deposited Date: 2009-10-23 Deposition Author(s): Blanco, F.J. , Bonet, R. , Cobos, E.S. , Iglesias-Bexiga, M. , Luque, I. , Macias, M.