PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

2HWN

Crystal structure of rii alpha dimerization/docking domain of pka bound to the d-akap2 peptide

PDB DOI: 10.2210/pdb2hwn/pdb

Classification: TRANSFERASE
Organism(s): Rattus Norvegicus , Synthetic Construct

Deposited: 2006-08-01
Deposition Author(s): Kim, C. , Kinderman, F.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 1.6 Å

2hwn
Literature

Crystal structure of rii alpha dimerization/docking domain of pka bound to the d-akap2 peptide

Kim, C. , Kinderman, F.

Primary Citation of Related Structures: 2HWN


Proteins
Molecule Chains Sequence Length Organism Sequence
cAMP-dependent protein kinase type II-alpha regulatory subunit A 45 Rattus Norvegicus , Synthetic Construct MSHIQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR
cAMP-dependent protein kinase type II-alpha regulatory subunit B 45 Rattus Norvegicus , Synthetic Construct MSHIQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR
cAMP-dependent protein kinase type II-alpha regulatory subunit C 45 Rattus Norvegicus , Synthetic Construct MSHIQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR
cAMP-dependent protein kinase type II-alpha regulatory subunit D 45 Rattus Norvegicus , Synthetic Construct MSHIQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR
A Kinase binding peptide E 22 Rattus Norvegicus , Synthetic Construct QEELAWKIAKMIVSDVMQQCKK
A Kinase binding peptide F 22 Rattus Norvegicus , Synthetic Construct QEELAWKIAKMIVSDVMQQCKK
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2006-08-01
Deposition Author(s): Kim, C. , Kinderman, F.