Crystal structure of rii alpha dimerization/docking domain of pka bound to the d-akap2 peptide
PDB DOI: 10.2210/pdb2hwn/pdb
Classification: TRANSFERASE Organism(s): Rattus Norvegicus , Synthetic Construct
Deposited: 2006-08-01 Deposition Author(s): Kim, C. , Kinderman, F.
Crystal structure of rii alpha dimerization/docking domain of pka bound to the d-akap2 peptide
Primary Citation of Related Structures: 2HWN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| cAMP-dependent protein kinase type II-alpha regulatory subunit | A | 45 | Rattus Norvegicus , Synthetic Construct | MSHIQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR |
| cAMP-dependent protein kinase type II-alpha regulatory subunit | B | 45 | Rattus Norvegicus , Synthetic Construct | MSHIQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR |
| cAMP-dependent protein kinase type II-alpha regulatory subunit | C | 45 | Rattus Norvegicus , Synthetic Construct | MSHIQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR |
| cAMP-dependent protein kinase type II-alpha regulatory subunit | D | 45 | Rattus Norvegicus , Synthetic Construct | MSHIQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR |
| A Kinase binding peptide | E | 22 | Rattus Norvegicus , Synthetic Construct | QEELAWKIAKMIVSDVMQQCKK |
| A Kinase binding peptide | F | 22 | Rattus Norvegicus , Synthetic Construct | QEELAWKIAKMIVSDVMQQCKK |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-08-01 Deposition Author(s): Kim, C. , Kinderman, F.