Crystal structure of the c-terminal sh3 domain of the adaptor protein gads in complex with slp-76 motif peptide reveals a unique sh3-sh3 interaction
PDB DOI: 10.2210/pdb2d0n/pdb
Classification: SIGNALING PROTEIN Organism(s): Mus Musculus , Synthetic Construct
Deposited: 2005-08-04 Deposition Author(s): Dimasi, N.
Method: X-RAY DIFFRACTION Resolution: 1.57 Å
Crystal structure of the c-terminal sh3 domain of the adaptor protein gads in complex with slp-76 motif peptide reveals a unique sh3-sh3 interaction
Primary Citation of Related Structures: 2D0N
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
GRB2-related adaptor protein 2 | A | 59 | Mus Musculus , Synthetic Construct | GSPWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMMR |
GRB2-related adaptor protein 2 | C | 59 | Mus Musculus , Synthetic Construct | GSPWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMMR |
SLP-76 binding peptide | B | 9 | Mus Musculus , Synthetic Construct | PSIDRSTKP |
SLP-76 binding peptide | D | 9 | Mus Musculus , Synthetic Construct | PSIDRSTKP |
Method: X-RAY DIFFRACTION
Deposited Date: 2005-08-04 Deposition Author(s): Dimasi, N.