Structural basis of snt ptb domain interactions with distinct neurotrophic receptors
PDB DOI: 10.2210/pdb1xr0/pdb
Classification: SIGNALING PROTEIN/GROWTH FACTOR RECEPTOR Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2004-10-13 Deposition Author(s): Dhalluin, C. , Goldfarb, M.P. , Kuti, M. , Lee, K.W. , Mujtaba, S. , Plotnikova, O. , Yan, K.S. , Zeng, L. , Zhou, M.-M.
Method: SOLUTION NMR Resolution: N.A.
Structural basis of snt ptb domain interactions with distinct neurotrophic receptors
Dhalluin, C. , Goldfarb, M.P. , Kuti, M. , Lee, K.W. , Mujtaba, S. , Plotnikova, O. , Yan, K.S. , Zeng, L. , Zhou, M.-M.
Primary Citation of Related Structures: 1XR0
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Basic fibroblast growth factor receptor 1 | A | 22 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | HSQMAVHKLAKSIPLRRQVTVS |
FGFR signalling adaptor SNT-1 | B | 129 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MGSDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEPVVERNNHQTELEVPRTPRTP |
Method: SOLUTION NMR
Deposited Date: 2004-10-13 Deposition Author(s): Dhalluin, C. , Goldfarb, M.P. , Kuti, M. , Lee, K.W. , Mujtaba, S. , Plotnikova, O. , Yan, K.S. , Zeng, L. , Zhou, M.-M.