Solution structure of the 3rd fibronectin type iii domain from mouse biregional cell adhesion molecule-related/down-regulated oncogenes (cdon) binding protein
PDB DOI: 10.2210/pdb1x4y/pdb
Classification: CELL ADHESION Organism(s): Enterobacter Aerogenes
Deposited: 2005-05-15 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tomizawa, T. , Yokoyama, S.
Solution structure of the 3rd fibronectin type iii domain from mouse biregional cell adhesion molecule-related/down-regulated oncogenes (cdon) binding protein
Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tomizawa, T. , Yokoyama, S.
Primary Citation of Related Structures: 1X4Y
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
biregional cell adhesion molecule-related/down-regulated oncogenes (Cdon)binding protein | A | 114 | Enterobacter Aerogenes | GSSGSSGPVAGPYITFTDAVNETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDMVEGDRYWHSISHLQPETSYDIKMQCFNEGGESEFSNVMICETKARSGPSSG |
Method: SOLUTION NMR
Deposited Date: 2005-05-15 Deposition Author(s): Inoue, M. , Kigawa, T. , Koshiba, S. , Riken Structural Genomics/Proteomics Initiative (Rsgi) , Tomizawa, T. , Yokoyama, S.