Solution structure of the second ww domain of nedd4-2
PDB DOI: 10.2210/pdb1wr4/pdb
Classification: LIGASE Organism(s): Mus Musculus
Deposited: 2004-10-11 Deposition Author(s): Booker, G.W. , Kowalski, K. , Merkel, A.L.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the second ww domain of nedd4-2
Booker, G.W. , Kowalski, K. , Merkel, A.L.
Primary Citation of Related Structures: 1WR4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ubiquitin-protein ligase Nedd4-2 | A | 36 | Mus Musculus | GSPGLPSGWEERKDAKGRTYYVNHNNRTTTWTRPIM |
Method: SOLUTION NMR
Deposited Date: 2004-10-11 Deposition Author(s): Booker, G.W. , Kowalski, K. , Merkel, A.L.