Solution structure of actin-binding domain of troponin in ca2+-bound state
PDB DOI: 10.2210/pdb1vdj/pdb
Classification: CONTRACTILE PROTEIN Organism(s): Gallus Gallus
Deposited: 2004-03-22 Deposition Author(s): Murakami, K. , Ohki, S. , Tanokura, M. , Wakabayashi, T. , Yasunaga, T. , Yumoto, F.
Solution structure of actin-binding domain of troponin in ca2+-bound state
Murakami, K. , Ohki, S. , Tanokura, M. , Wakabayashi, T. , Yasunaga, T. , Yumoto, F.
Primary Citation of Related Structures: 1VDJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Troponin I, fast skeletal muscle | A | 52 | Gallus Gallus | KVNMDLRANLKQVKKEDTEKEKDLRDVGDWRKNIEEKSGMEGRKKMFEAGES |
Method: SOLUTION NMR
Deposited Date: 2004-03-22 Deposition Author(s): Murakami, K. , Ohki, S. , Tanokura, M. , Wakabayashi, T. , Yasunaga, T. , Yumoto, F.