PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

1RGJ

Nmr structure of the complex between alpha-bungarotoxin and mimotope of the nicotinic acetylcholine receptor with enhanced activity

PDB DOI: 10.2210/pdb1rgj/pdb

Classification: TOXIN
Organism(s): Rice Stripe Tenuivirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2003-11-12
Deposition Author(s): Bernini, A. , Bracci, L. , Ciutti, A. , Lelli, B. , Lozzi, L. , Neri, P. , Niccolai, N. , Scarselli, M. , Spiga, O.

Experimental Data Snapshot

Method: SOLUTION NMR
Resolution: N.A.

Literature

Nmr structure of the complex between alpha-bungarotoxin and mimotope of the nicotinic acetylcholine receptor with enhanced activity

Bernini, A. , Bracci, L. , Ciutti, A. , Lelli, B. , Lozzi, L. , Neri, P. , Niccolai, N. , Scarselli, M. , Spiga, O.

Primary Citation of Related Structures: 1RGJ


Proteins
Molecule Chains Sequence Length Organism Sequence
long neurotoxin 1 A 74 Rice Stripe Tenuivirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
MIMOTOPE OF THE NICOTINIC ACETYLCHOLINE RECEPTOR B 13 Rice Stripe Tenuivirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) FRYYESSLEPWDD
Experimental Data

Method: SOLUTION NMR

Deposited Date: 2003-11-12
Deposition Author(s): Bernini, A. , Bracci, L. , Ciutti, A. , Lelli, B. , Lozzi, L. , Neri, P. , Niccolai, N. , Scarselli, M. , Spiga, O.