>7oah_A mol:protein length:86 General control transcription factor GCN4,conserved hypothetical protein residues 311-335 from Candidatus Magnetomorum sp. HK-1 fused to GCN4 adaptors, mutant beta2/A,General control transcription factor GCN4
GGGSGMKQIEMKIEEILSKIYHIENEIARIKKLINLKANKADVATKDQLATKTEINSQMKQIEWKIEEILSKIYHIENEIARIKKL
>7oah_B mol:protein length:86 General control transcription factor GCN4,conserved hypothetical protein residues 311-335 from Candidatus Magnetomorum sp. HK-1 fused to GCN4 adaptors, mutant beta2/A,General control transcription factor GCN4
GGGSGMKQIEMKIEEILSKIYHIENEIARIKKLINLKANKADVATKDQLATKTEINSQMKQIEWKIEEILSKIYHIENEIARIKKL
>7oah_C mol:protein length:86 General control transcription factor GCN4,conserved hypothetical protein residues 311-335 from Candidatus Magnetomorum sp. HK-1 fused to GCN4 adaptors, mutant beta2/A,General control transcription factor GCN4
GGGSGMKQIEMKIEEILSKIYHIENEIARIKKLINLKANKADVATKDQLATKTEINSQMKQIEWKIEEILSKIYHIENEIARIKKL